A15739
ZNF134 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15739
- Additional Names:
- pHZ-15|ZNF134
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFH
- Uniprot:
- P52741
- Synonyms:
- pHZ-15;zinc finger protein 134;zinc finger protein 134 (clone pHZ-15)
- Extra Details:
- Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleoplasm.
- Shipping Conditions:
- Blue Ice