A15703
SERPINI1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15703
- Additional Names:
- HNS-S1|HNS-S2|neuroserpin|PI12|SERPINI1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 46kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
- Uniprot:
- Q99574
- Synonyms:
- HNS-S1;HNS-S2;neuroserpin;peptidase inhibitor 12;PI-12;PI12;serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1;serpin I1;serpin peptidase inhibitor clade I member 1;serpin peptidase inhibitor, clade I (neuroserpin), member 1;truncated HNS-T
- Extra Details:
- This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Shipping Conditions:
- Blue Ice