NDUFA4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15693
Additional Names:: CI-9k|CI-MLRQ|COXFA4|MC4DN21|MISTR1|MLRQ|MRCAF1|NDUFA4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Uniprot:: O00483
Synonyms:: CI-9k;CI-MLRQ;Complex I 9kDa subunit;complex I-MLRQ;COXFA4;cytochrome c oxidase subunit FA4;cytochrome c oxidase subunit NDUFA4;MC4DN21;MISTR1;mitochondrial respiratory chain associated factor 1;mitochondrial stress response 1;MLRQ;MRCAF1;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4;NADH-ubiquinone oxidoreductase MLRQ subunit
Extra Details:: The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.