A1569
TPH1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1569
- Additional Names:
- TPH1|TPRH|TRPH
- Application:
- ELISA, WB
- Molecular Weight:
- 51kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
- Uniprot:
- P17752
- Synonyms:
- indoleacetic acid-5-hydroxylase;L-tryptophan hydroxylase;TPRH;TRPH;tryptophan 5-hydroxylase 1;tryptophan 5-monooxygenase 1;tryptophan hydroxylase (tryptophan 5-monooxygenase)
- Extra Details:
- This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others.
- Shipping Conditions:
- Blue Ice