A15686
HSL Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15686
- Additional Names:
- AOMS4|FPLD6|HSL|LHS|REH
- Application:
- ELISA, WB
- Molecular Weight:
- 84kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TLSPSTPSDVNFLLPPEDAGEEAEAKNELSPMDRGLGVRAAFPEGFHPRRSSQGATQMPLYSSPIVKNPFMSPLLAPDSMLKSLPPVHIVACALDPMLDDS
- Uniprot:
- Q05469
- Synonyms:
- AOMS4;FPLD6;hormone-sensitive lipase;HSL;LHS;lipase, hormone-sensitive;monoacylglycerol lipase LIPE;REH;retinyl ester hydrolase
- Extra Details:
- The protein encoded by this gene has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.
- Shipping Conditions:
- Blue Ice