A15680
IL10RB Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15680
- Additional Names:
- CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IBD25|IL-10R2|IL-10RB|IL10RB
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPS
- Uniprot:
- Q08334
- Synonyms:
- CDW210B;CRF2-4;CRFB4;cytokine receptor class-II CRF2-4;cytokine receptor class-II member 4;cytokine receptor family 2 member 4;cytokine receptor family II, member 4;D21S58;D21S66;IL-10 receptor subunit beta;IL-10R subunit 2;IL-10R subunit beta;IL-10R2;IL-10RB;interleukin 10 receptor, beta;interleukin-10 receptor subunit 2;interleukin-10 receptor subunit beta
- Extra Details:
- The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
- Shipping Conditions:
- Blue Ice



