Monoamine Oxidase B (MAOB) Rabbit polyclonal antibody

Size

£152.00

SKU:: A1568
Additional Names:: MAOB|Monoamine Oxidase B (MAOB)
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP
Uniprot:: P27338
Synonyms:: adrenalin oxidase;amine oxidase [flavin-containing] B;MAO-B;MAO, brain;MAO, platelet;monoamine oxidase type B;tyramine oxidase
Extra Details:: The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.