A15677
GSTM5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15677
- Additional Names:
- GSTM5|GSTM5-5|GTM5
- Application:
- ELISA, WB
- Molecular Weight:
- 24-26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
- Uniprot:
- P46439
- Synonyms:
- epididymis secretory sperm binding protein;glutathione S-alkyltransferase M5;glutathione S-aralkyltransferase M5;glutathione S-aryltransferase M5;glutathione S-transferase M5;glutathione S-transferase Mu 5;GST class-mu 5;GSTM5-5;GTM5;S-(hydroxyalkyl)glutathione lyase M5
- Extra Details:
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.
- Shipping Conditions:
- Blue Ice

