RNF149 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15627
Additional Names:: DNAPTP2|RNF149
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: FYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDDSSPPSASPAESEPQCDPSFKGDAGENTALLEAGRSDSRHGGPIS
Uniprot:: Q8NC42
Synonyms:: DNA polymerase-transactivated protein 2;DNAPTP2;E3 ubiquitin-protein ligase RNF149;RING finger protein 149;RING-type E3 ubiquitin transferase RNF149
Extra Details:: Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cellular response to xenobiotic stimulus; negative regulation of MAPK cascade; and regulation of protein stability. Located in membrane.