NDUFB11 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15617
Additional Names:: CI-ESSS|ESSS|MC1DN30|NDUFB11|Np15|NP17.3|P17.3
Application:: ELISA, WB
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRCTGCPRAWDGMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Uniprot:: Q9NX14
Synonyms:: CI-ESSS;complex I NP17.3 subunit;complex I-ESSS;ESSS;MC1DN30;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial;NADH-ubiquinone oxidoreductase ESSS subunit;neuronal protein 17.3;Np15;NP17.3;P17.3
Extra Details:: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to ubiquinone. Mutations in the human gene are associated with linear skin defects with multiple congenital anomalies 3 and mitochondrial complex I deficiency.