TRAF7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15607
Additional Names:: CAFDADD|RFWD1|RNF119|TRAF7
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: PHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVW
Uniprot:: Q6Q0C0
Synonyms:: CAFDADD;E3 ubiquitin-protein ligase TRAF7;RFWD1;ring finger and WD repeat domain 1;RING finger and WD repeat-containing protein 1;RING finger protein 119;RING-type E3 ubiquitin transferase TRAF7;RNF119;TNF receptor-associated factor 7;TNF receptor-associated factor 7, E3 ubiquitin protein ligase
Extra Details:: Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.