PDE10A Rabbit polyclonal antibody

Size

£152.00

SKU:: A15597
Additional Names:: ADSD2|HSPDE10A|IOLOD|LINC00473|PDE10A|PDE10A19
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 88kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLC
Uniprot:: Q9Y233
Synonyms:: 3',5' cAMP/cGMP phosphodiesterase;ADSD2;cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A;dJ416F21.1 (phosphodiesterase 10A);HSPDE10A;IOLOD;LINC00473;PDE10A19;phosphodiesterase 10A1 (PDE10A1);phosphodiesterase 10A7 (PDE10A7)
Extra Details:: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase family. It plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This protein can hydrolyze both cAMP and cGMP to the corresponding nucleoside 5' monophosphate, but has higher affinity for cAMP, and is more efficient with cAMP as substrate. Alternatively spliced transcript variants have been described for this gene.