A15574
STT3B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15574
- Additional Names:
- CDG1X|SIMP|STT3-B|STT3B
- Application:
- ELISA, WB
- Molecular Weight:
- 102kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIH
- Uniprot:
- Q8TCJ2
- Synonyms:
- CDG1X;dolichyl-diphosphooligosaccharide protein glycotransferase;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B;homolog of yeast STT3;oligosaccharyl transferase subunit STT3B;SIMP;source of immunodominant MHC-associated peptides homolog;STT3-B;STT3, subunit of the oligosaccharyltransferase complex, homolog B;STT3B, catalytic subunit of the oligosaccharyltransferase complex;STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
- Extra Details:
- The protein encoded by this gene is a catalytic subunit of a protein complex that transfers oligosaccharides onto asparagine residues. Defects in this gene are a cause of congenital disorder of glycosylation Ix (CDG1X).
- Shipping Conditions:
- Blue Ice