A15573
ADGRA3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15573
- Additional Names:
- ADGRA3|GPR125|PGR21|TEM5L
- Application:
- ELISA, WB
- Molecular Weight:
- 146kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
- Uniprot:
- Q8IWK6
- Synonyms:
- adhesion G protein-coupled receptor A3;G-protein coupled receptor 125;GPR125;PGR21;probable G-protein coupled receptor 125;TEM5L
- Extra Details:
- This gene encodes a member of the G protein-coupled receptor superfamily. This membrane protein may play a role in tumor angiogenesis through its interaction with the human homolog of the Drosophila disc large tumor suppressor gene. This gene is mapped to a candidate region of chromosome 4 which may be associated with bipolar disorder and schizophrenia.
- Shipping Conditions:
- Blue Ice

