A15565
HEXIM2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15565
- Additional Names:
- HEXIM2|L3
- Application:
- ELISA, WB
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
- Uniprot:
- Q96MH2
- Synonyms:
- hexamethylene bis-acetamide inducible 2;hexamethylene bis-acetamide-inducible protein 2;hexamethylene bisacetamide inducible 2;hexamethylene-bis-acetamide-inducible transcript 2;L3;MAQ1 paralog;protein HEXIM2
- Extra Details:
- This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

