DNER Rabbit polyclonal antibody

Size

£152.00

SKU:: A15551
Additional Names:: bet|DNER|UNQ26
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
Uniprot:: Q8NFT8
Synonyms:: bet;delta and Notch-like epidermal growth factor-related receptor;delta-notch-like EGF repeat-containing transmembrane;H_NH0150O02.1;UNQ26;WUGSC:H_NH0150O02.1
Extra Details:: Predicted to enable Notch binding activity. Involved in central nervous system development. Located in dendrite; early endosome; and plasma membrane.