A1555
Caveolin-1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1555
- Additional Names:
- BSCL3|Caveolin-1|CGL3|LCCNS|MSTP085|PPH3|VIP21
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 21 kDa/24 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS
- Uniprot:
- Q03135
- Synonyms:
- BSCL3;caveolin 1, caveolae protein, 22kDa;caveolin-1;cell growth-inhibiting protein 32;CGL3;LCCNS;MSTP085;PPH3;VIP21
- Extra Details:
- The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.
- Shipping Conditions:
- Blue Ice








