TPD52L3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15544
Additional Names:: D55|hD55|NYDSP25|TPD52L3|TPD55
Application:: ELISA, WB, IF
Molecular Weight:: 13kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI
Uniprot:: Q96J77
Synonyms:: D55;hD55;NYDSP25;protein kinase NYD-SP25;testis development protein NYD-SP25;testis tissue sperm-binding protein Li 87P;TPD55;tumor protein D52 like 3;Tumor protein D52-like 3;tumor protein D55
Extra Details:: This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.