SPPL2A Rabbit polyclonal antibody

Size

£152.00

SKU:: A15539
Additional Names:: IMD86|IMP3|PSL2|SPPL2A
Application:: ELISA, WB, IHC-P
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
Uniprot:: Q8TCT8
Synonyms:: IMP-3;IMP3;intramembrane cleaving protease;intramembrane protease 3;presenilin-like protein 2;PSL2;signal peptide peptidase-like 2A;SPP-like 2A
Extra Details:: This gene encodes a member of the GXGD family of aspartic proteases, which are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions, as well as a member of the signal peptide peptidase-like protease (SPPL) family. This protein is expressed in all major adult human tissues and localizes to late endosomal compartments and lysosomal membranes. A pseudogene of this gene also lies on chromosome 15.