A15537
HOPX Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15537
- Additional Names:
- CAMEO|HOD|HOP|HOPX|LAGY|NECC1|OB1|SMAP31|TOTO
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
- Uniprot:
- Q9BPY8
- Synonyms:
- CAMEO;HOD;homeodomain-only protein;HOP;LAGY;lung cancer-associated Y protein;NECC1;not expressed in choriocarcinoma clone 1;Not expressed in choriocarcinoma protein 1;OB1;odd homeobox protein 1;SMAP31;TOTO
- Extra Details:
- The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene.
- Shipping Conditions:
- Blue Ice



