HOPX Rabbit polyclonal antibody

Size

£152.00

SKU:: A15537
Additional Names:: CAMEO|HOD|HOP|HOPX|LAGY|NECC1|OB1|SMAP31|TOTO
Application:: ELISA, WB, IF
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Uniprot:: Q9BPY8
Synonyms:: CAMEO;HOD;homeodomain-only protein;HOP;LAGY;lung cancer-associated Y protein;NECC1;not expressed in choriocarcinoma clone 1;Not expressed in choriocarcinoma protein 1;OB1;odd homeobox protein 1;SMAP31;TOTO
Extra Details:: The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene.