KCNH6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15522
Additional Names:: ERG-2|ERG2|hERG-2|HERG2|KCNH6|Kv11.2
Application:: ELISA, WB
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVT
Uniprot:: Q9H252
Synonyms:: eag-related gene member 2;ERG-2;ERG2;Ether-a-go-go-related gene potassium channel 2;ether-a-go-go-related protein 2;hERG-2;HERG2;Kv11.2;potassium channel, voltage gated eag related subfamily H, member 6;potassium voltage-gated channel subfamily H member 6;potassium voltage-gated channel, subfamily H (eag-related), member 6;voltage-gated potassium channel subunit Kv11.2
Extra Details:: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Alternative splicing results in multiple transcript variants that encode different isoforms.

Shipping Conditions:: Blue Ice