RAPH1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15506
Additional Names:: ALS2CR18|ALS2CR9|LPD|PREL-2|PREL2|RalGDS/AF-6|RAPH1|RMO1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 200kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQKLPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
Uniprot:: Q70E73
Synonyms:: ALS2CR18;ALS2CR9;amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 18;amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 9;Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein;Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein;lamellipodin;LPD;PREL-2;PREL2;proline-rich EVH1 ligand 2;Protein RMO1;RalGDS/AF-6;ras-associated and pleckstrin homology domains-containing protein 1;RMO1
Extra Details:: This gene encodes a protein that belongs to the Mig10/Rap1-interacting adaptor molecule/Lamellipodin family of adapter proteins, which function in cell migration. Members of this family contain pleckstrin-homology domains, Ras-association domains, and proline-rich C-termini. The protein encoded by this gene regulates actin dynamics through interaction with Ena/Vasodilator proteins as well as direct binding to filamentous actin to regulate actin network assembly. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice