NECAB3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15500
Additional Names:: APBA2BP|dJ63M2.4|dJ63M2.5|EFCBP3|NECAB3|NIP1|STIP3|SYTIP2|XB51
Application:: ELISA, WB
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
Uniprot:: Q96P71
Synonyms:: amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein;amyloid beta A4 protein-binding family A member 2-binding protein;Amyloid-beta A4 protein-binding family A member 2-binding protein;APBA2BP;dJ63M2.4;dJ63M2.5;EF-hand calcium binding protein 3;EFCBP3;N-terminal EF-hand calcium-binding protein 3;Nek2-interacting protein 1;neuronal calcium-binding protein 3;neuronal calcium-binding protein NECAB3;NIP1;STIP3;synaptotagmin interacting protein 2;synaptotagmin interacting protein STIP3;SYTIP2;X11L-binding protein 51;XB51
Extra Details:: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice