MS4A7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15495
Additional Names:: 4SPAN2|CD20L4|CFFM4|MS4A7|MS4A8
Application:: ELISA, WB
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAA
Uniprot:: Q9GZW8
Synonyms:: 4SPAN2;CD20 antigen-like 4;CD20/Fc-epsilon-RI-beta family member 4;CD20L4;CFFM4;four-span transmembrane protein 2;high affinity immunoglobulin epsilon receptor beta subunit;membrane-spanning 4-domains subfamily A member 7;MS4A8
Extra Details:: This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.