A1548
eNOS Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1548
- Additional Names:
- ECNOS|eNOS
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 140 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDTNSP
- Uniprot:
- P29474
- Synonyms:
- cNOS;constitutive NOS;EC-NOS;ECNOS;endothelial NOS;eNOS;nitric oxide synthase 3 (endothelial cell);nitric oxide synthase 3 transcript variant eNOS-delta20;nitric oxide synthase 3 transcript variant eNOS-delta20-21;nitric oxide synthase 3 transcript variant eNOS-delta21;nitric oxide synthase, endothelial;NOS type III;NOSIII
- Extra Details:
- Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice





