eNOS Rabbit polyclonal antibody

Size

£152.00

SKU:: A1548
Additional Names:: ECNOS|eNOS
Application:: ELISA, WB, IF
Molecular Weight:: 140 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDTNSP
Uniprot:: P29474
Synonyms:: cNOS;constitutive NOS;EC-NOS;ECNOS;endothelial NOS;eNOS;nitric oxide synthase 3 (endothelial cell);nitric oxide synthase 3 transcript variant eNOS-delta20;nitric oxide synthase 3 transcript variant eNOS-delta20-21;nitric oxide synthase 3 transcript variant eNOS-delta21;nitric oxide synthase, endothelial;NOS type III;NOSIII
Extra Details:: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Alternative splicing and the use of alternative promoters results in multiple transcript variants.