A15476
CDK5RAP2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15476
- Additional Names:
- C48|CDK5RAP2|Cep215|MCPH3
- Application:
- ELISA, WB
- Molecular Weight:
- 250kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS
- Uniprot:
- Q96SN8
- Synonyms:
- C48;CDK5 activator-binding protein C48;CDK5 regulatory subunit-associated protein 2;centrosomal protein 215 kDa;Centrosome-associated protein 215;centrosomin;Cep215;MCPH3
- Extra Details:
- This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimer's disease. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice