ZNF331 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15470
Additional Names:: RITA|ZNF331|ZNF361|ZNF463
Application:: ELISA, WB
Molecular Weight:: 62kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS
Uniprot:: Q9NQX6
Synonyms:: C2H2-like zinc finger protein rearranged in thyroid adenomas;KRAB zinc finger protein;RITA;zinc finger protein 331;zinc finger protein 361;zinc finger protein 463;ZNF361;ZNF463
Extra Details:: This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.