A15458
PXK Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15458
- Additional Names:
- MONAKA|PXK|SLOB
- Application:
- ELISA, WB
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKL
- Uniprot:
- Q7Z7A4
- Synonyms:
- Modulator of Na,K-ATPase;modulator of Na,K-ATPase long form;MONAKA;PX domain-containing protein kinase-like protein;PX ser/thr kinase v2;PX serine/threonine kinase;SLOB
- Extra Details:
- This gene encodes a phox (PX) domain-containing protein which may be involved in synaptic transmission and the ligand-induced internalization and degradation of epidermal growth factors. Variations in this gene may be associated with susceptibility to systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice