[KO Validated] GIT1 Rabbit polyclonal antibody

Size

POA

SKU:: A15437
Additional Names:: p95-APP1|T1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP
Uniprot:: Q9Y2X7
Synonyms:: ARF GAP GIT1;ARF GTPase-activating protein GIT1;CAT-1;CAT1;cool-associated and tyrosine-phosphorylated protein 1;G protein-coupled receptor kinase interacting ArfGAP 1;G protein-coupled receptor kinase-interactor 1;GRK-interacting protein 1;p95-APP1
Extra Details:: Enables gamma-tubulin binding activity. Involved in positive regulation of microtubule nucleation and regulation of cytokinesis. Located in several cellular components, including focal adhesion; microtubule cytoskeleton; and mitochondrion. Implicated in attention deficit hyperactivity disorder. Biomarker of Huntington's disease.