SULT1C4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15433
Additional Names:: SULT1C|SULT1C2|SULT1C4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPS
Uniprot:: O75897
Synonyms:: ST1C4;sulfotransferase 1C2;sulfotransferase 1C4;sulfotransferase family, cytosolic, 1C, member 2;sulfotransferase family, cytosolic, 1C, member 4;sulfotransferase family, cytosolic, 1C, member C2;SULT1C;SULT1C#2;SULT1C2
Extra Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.