SLC44A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15413
Additional Names:: CD92|CDW92|CHTL1|CONATOC|CTL1|SLC44A1
Application:: ELISA, WB
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT
Uniprot:: Q8WWI5
Synonyms:: CD92;CDW92;CDW92 antigen;choline transporter-like protein 1;CHTL1;CONATOC;CTL1;solute carrier family 44 (choline transporter), member 1;Solute carrier family 44 member 1
Extra Details:: Enables choline transmembrane transporter activity. Involved in choline transport and transmembrane transport. Located in several cellular components, including cytosol; mitochondrion; and nucleoplasm. Implicated in high grade glioma.