CRTC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15412
Additional Names:: CRTC1|Mam-2|MAML2|MECT1|TORC-1|TORC1|WAMTP1
Application:: ELISA, WB
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLS
Uniprot:: Q6UUV9
Synonyms:: CREB-regulated transcription coactivator 1;Mam-2;MAML2;Mastermind-like protein 2;MECT1;mucoepidermoid carcinoma translocated protein 1;TORC-1;TORC1;transducer of regulated cAMP response element-binding protein (CREB) 1;Transducer of regulated cAMP response element-binding protein 1;WAMTP1
Extra Details:: Enables cAMP response element binding protein binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in cytosol; nuclear body; and plasma membrane.