A15379
PRG4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15379
- Additional Names:
- CACP|HAPO|JCAP|MSF|PRG4|SZP
- Application:
- ELISA, WB
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
- Uniprot:
- Q92954
- Synonyms:
- articular superficial zone protein;CACP;HAPO;hemangiopoietin;JCAP;lubricin;megakaryocyte stimulating factor;Megakaryocyte-stimulating factor;MSF;proteoglycan 4;superficial zone proteoglycan;SZP
- Extra Details:
- The protein encoded by this gene is a large proteoglycan that is synthesized by chondrocytes located at the surface of articular cartilage and by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice