A15376
COL4A3BP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15376
- Additional Names:
- CERT|CERTL|COL4A3BP|GPBP|MRD34|STARD11
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 71kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
- Uniprot:
- Q9Y5P4
- Synonyms:
- ceramide transfer protein;CERT;CERTL;COL4A3BP;collagen type IV alpha 3 binding protein;collagen, type IV, alpha 3 (Goodpasture antigen) binding protein;Goodpasture antigen-binding protein;GPBP;lipid-transfer protein CERTL;MRD34;StAR-related lipid transfer (START) domain containing 11;StAR-related lipid transfer protein 11;STARD11;START domain-containing protein 11
- Extra Details:
- This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice