A15372
FIG4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15372
- Additional Names:
- ALS11|BOP|BTOP|CMT4J|dJ249I4.1|FIG4|KIAA0274|SAC3|YVS
- Application:
- ELISA, WB
- Molecular Weight:
- 104kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYREYIRNRYL
- Uniprot:
- Q92562
- Synonyms:
- ALS11;BTOP;CMT4J;dJ249I4.1;FIG4 homolog, SAC domain containing lipid phosphatase;FIG4 homolog, SAC1 domain containing lipid phosphatase;FIG4 homolog, SAC1 lipid phosphatase domain containing;KIAA0274;phosphatidylinositol 3,5-bisphosphate 5-phosphatase;polyphosphoinositide phosphatase;Sac domain-containing inositol phosphatase 3;SAC domain-containing protein 3;SAC3;YVS
- Extra Details:
- The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J.
- Shipping Conditions:
- Blue Ice

