A15357
EEF1E1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15357
- Additional Names:
- AIMP3|EEF1E1|P18
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS
- Uniprot:
- O43324
- Synonyms:
- AIMP3;aminoacyl tRNA synthetase complex-interacting multifunctional protein 3;ARS-interacting multifunctional protein 3;Elongation factor p18;eukaryotic translation elongation factor 1 epsilon-1;multisynthase complex auxiliary component p18;P18;p18 component of aminoacyl-tRNA synthetase complex
- Extra Details:
- This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
- Shipping Conditions:
- Blue Ice