A15355
THEMIS2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15355
- Additional Names:
- C1orf38|ICB-1|ICB1|THEMIS2
- Application:
- ELISA, WB
- Molecular Weight:
- 72kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQTMELAPNFQGYFTPLNTPQSYETLEELVSATTQSSKQLPTCFMSTHRIVTEGRVVTEDQLLMLEAVVMHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR
- Uniprot:
- Q5TEJ8
- Synonyms:
- basement membrane-induced;C1orf38;ICB-1;ICB1;induced by contact to basement membrane 1 protein;protein ICB-1;protein THEMIS2;thymocyte-expressed molecule involved in selection protein 2
- Extra Details:
- Predicted to be involved in T cell receptor signaling pathway and regulation of B cell activation. Predicted to be active in cytoplasm and nucleus.
- Shipping Conditions:
- Blue Ice