GSTO1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15354
Additional Names:: GSTO 1-1|GSTO1|GSTTLp28|HEL-S-21|P28|SPG-R
Application:: ELISA, WB
Molecular Weight:: 27kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Uniprot:: P78417
Synonyms:: epididymis secretory protein Li 21;glutathione S-transferase omega 1-1;glutathione S-transferase omega-1;glutathione-dependent dehydroascorbate reductase;glutathione-S-transferase like;GSTO 1-1;GSTTLp28;HEL-S-21;MMA(V) reductase;monomethylarsonic acid reductase;P28;S-(Phenacyl)glutathione reductase;SPG-R
Extra Details:: The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene.