A15335
PTP4A2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15335
- Additional Names:
- HH13|HH7-2|HU-PP-1|OV-1|PRL-2|PRL2|ptp-IV1a|ptp-IV1b|PTP4A|PTP4A2|PTPCAAX2
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVH
- Uniprot:
- Q12974
- Synonyms:
- HH13;HH7-2;HU-PP-1;OV-1;phosphatase of regenerating liver 2;PRL-2;PRL2;protein tyrosine phosphatase IVA;protein tyrosine phosphatase IVA2;protein tyrosine phosphatase type IVA 2;protein tyrosine phosphatase type IVA, member 2;Protein-tyrosine phosphatase 4a2;protein-tyrosine phosphatase of regenerating liver 2;ptp-IV1a;ptp-IV1b;PTP(CAAXII);PTP4A;PTPCAAX2
- Extra Details:
- The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
- Shipping Conditions:
- Blue Ice