A15301
PKNOX1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15301
- Additional Names:
- PKNOX1|pkonx1c|PREP1
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALAPAHISGLVLENSDSLQ
- Uniprot:
- P55347
- Synonyms:
- homeobox protein PKNOX1;homeobox protein PREP-1;human homeobox-containing protein;Pbx regulating protein-1;PBX/knotted homeobox 1;pkonx1c;PREP1
- Extra Details:
- Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in angiogenesis and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within camera-type eye development; hemopoiesis; and positive regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm and nucleus. Predicted to be part of chromatin.
- Shipping Conditions:
- Blue Ice