A15291
MYF6 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15291
- Additional Names:
- bHLHc4|CNM3|MRF4|myf-6|MYF6
- Application:
- ELISA, WB
- Molecular Weight:
- 27kDa/37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
- Uniprot:
- P23409
- Synonyms:
- bHLHc4;class C basic helix-loop-helix protein 4;CNM3;MRF4;muscle-specific regulatory factor 4;myf-6;myogenic factor 6;myogenic factor 6 (herculin)
- Extra Details:
- The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM).
- Shipping Conditions:
- Blue Ice