Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit polyclonal antibody

Size

£152.00

SKU:: A15276
Additional Names:: GC-S-beta-1|GC-SB3|Guanylyl Cyclase beta 1 (GUCY1B3)|GUC1B3|GUCB3|GUCSB3|GUCY1B3
Application:: ELISA, WB
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSL
Uniprot:: Q02153
Synonyms:: GC-S-beta-1;GC-SB3;GCS-beta-1;GCS-beta-3;guanylate cyclase 1, soluble, beta 3;guanylate cyclase soluble subunit beta-1;guanylate cyclase soluble subunit beta-3;GUC1B3;GUCB3;GUCSB3;GUCY1B3;soluble guanylate cyclase small subunit
Extra Details:: This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants.