A15263
CENPE Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15263
- Additional Names:
- CENP-E|CENPE|KIF10|MCPH13|PPP1R61
- Application:
- ELISA, WB
- Molecular Weight:
- 270kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHLSNEVKTWKERTLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESPKSCFFDSRSKSLPSPHPVRYFDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKTQ
- Uniprot:
- Q02224
- Synonyms:
- CENP-E;Centromere autoantigen E (312kD);Centromere protein E;centromere protein E, 312kDa;centromere-associated protein E;KIF10;kinesin family member 10;kinesin-7;kinesin-related protein CENPE;MCPH13;PPP1R61;protein phosphatase 1, regulatory subunit 61
- Extra Details:
- Centrosome-associated protein E (CENPE) is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. This protein is required for stable spindle microtubule capture at kinetochores which is a necessary step in chromosome alignment during prometaphase. This protein also couples chromosome position to microtubule depolymerizing activity. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms.
- Shipping Conditions:
- Blue Ice

