A15250
UNC93B1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15250
- Additional Names:
- IIAE1|Unc-93B1|UNC93|UNC93B|UNC93B1
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDES
- Uniprot:
- Q9H1C4
- Synonyms:
- IIAE1;protein unc-93 homolog B1;unc-93 related protein;Unc-93B1;UNC93;unc93 homolog B1;UNC93B
- Extra Details:
- This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficiency of the encoded protein has been associated with herpes simplex encephalitis.
- Shipping Conditions:
- Blue Ice