A15245
EPRS Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15245
- Additional Names:
- EARS|EPRS|GLUPRORS|HLD15|PARS|PIG32|QARS|QPRS
- Application:
- ELISA, WB
- Molecular Weight:
- 190kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
- Uniprot:
- P07814
- Synonyms:
- bifunctional aminoacyl-tRNA synthetase;bifunctional glutamate/proline--tRNA ligase;cell proliferation-inducing gene 32 protein;EARS;EPRS;GLUPRORS;glutamate tRNA ligase;glutamatyl-prolyl-tRNA synthetase;glutaminyl-tRNA synthetase;HLD15;PARS;PIG32;proliferation-inducing gene 32 protein;proliferation-inducing protein 32;proline-tRNA ligase;prolyl-tRNA synthetase;QARS;QPRS
- Extra Details:
- Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
- Shipping Conditions:
- Blue Ice