Caspase-7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1524
Additional Names:: CASP-7|Caspase-7|CMH-1|ICE-LAP3|LICE2|MCH3
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILE
Uniprot:: P55210
Synonyms:: apoptotic protease MCH-3;CASP-7;caspase 7, apoptosis-related cysteine peptidase;caspase 7, apoptosis-related cysteine protease;caspase-7;CMH-1;ICE-LAP3;ICE-like apoptotic protease 3;LICE2;MCH3
Extra Details:: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.