Dopamine Transporter/SLC6A3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15236
Additional Names:: DAT|DAT1|Dopamine Transporter/SLC6A3|PKDYS|PKDYS1
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLV
Uniprot:: Q01959
Synonyms:: DA transporter;DAT;DAT1;dopamine transporter 1;PKDYS;PKDYS1;sodium-dependent dopamine transporter;solute carrier family 6 (neurotransmitter transporter, dopamine), member 3;solute carrier family 6 (neurotransmitter transporter), member 3;Solute carrier family 6 member 3
Extra Details:: This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.