TCTE1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15216
Additional Names:: D6S46|DRC5|FAP155|TCTE1
Application:: ELISA, WB
Molecular Weight:: 66kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MQDTVTTSALLDPSHSSVSTQDNSSTGGHTSSTSPQLSKPSITPVPAKSRNPHPRANIRRMRRIIAEDPEWSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWPVCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGDQSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIII
Uniprot:: Q5JU00
Synonyms:: D6S46;DRC5;dynein regulatory complex subunit 5;FAP155;T-complex-associated testis-expressed protein 1;tcte-1
Extra Details:: Predicted to be involved in flagellated sperm motility. Predicted to be located in sperm flagellum.