A15215
LIPH Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15215
- Additional Names:
- AH|ARWH2|HYPT7|LAH2|LIPH|LPDLR|mPA-PLA1|PLA1B
- Application:
- ELISA, WB
- Molecular Weight:
- 54kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ
- Uniprot:
- Q8WWY8
- Synonyms:
- AH;ARWH2;HYPT7;LAH2;lipase member H;lipase, member H;LPD lipase-related protein;LPDLR;membrane-associated phosphatidic acid-selective phospholipase A1-alpha;membrane-bound phosphatidic acid-selective phospholipase A1;mPA-PLA1;mPA-PLA1 alpha;phospholipase A(1);phospholipase A1 member B;PLA1B
- Extra Details:
- This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.
- Shipping Conditions:
- Blue Ice