A15193
COQ10B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15193
- Additional Names:
- COQ10B
- Application:
- ELISA, WB
- Molecular Weight:
- 27kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKA
- Uniprot:
- Q9H8M1
- Synonyms:
- coenzyme Q-binding protein COQ10 homolog B, mitochondrial;coenzyme Q10 homolog B
- Extra Details:
- Predicted to enable ubiquinone binding activity. Predicted to be involved in cellular respiration and ubiquinone biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be active in mitochondrion.
- Shipping Conditions:
- Blue Ice